This entry does not currently have a verified structure file for the interactive viewer, so structure presentation is limited.
Help improve the information
Suggest a correction, missing detail, or peptide addition by .
Not FDA approved
This peptide is not FDA approved for human use, and because peptides are often incompletely studied you should not use or self-experiment with it outside qualified medical supervision.
Overview
CJC-1295 DAC is a long-acting growth hormone-releasing hormone version in which CJC-1295 has a maleimidopropionamide-lysine Drug Affinity Complex added to prolong albumin binding and exposure. It is not FDA approved, is prohibited by WADA, and the published human data are limited to short healthy-adult studies showing sustained GH and IGF-I increases rather than proof of benefit for growth hormone deficiency or body composition.
Reported benefits
- Published human pharmacokinetic and pharmacodynamic data in healthy adults.
- Long-acting design intended to extend exposure through albumin binding.
- Sustained GH and IGF-I increases after subcutaneous dosing in short studies.
Mechanism of action
FDA's 2024 review describes CJC-1295 DAC as CJC-1295 with a maleimidopropionamide-lysine unit added at the C terminus. That DAC modification enables in-vivo bioconjugation with serum albumin and contributes to the longer half-life (how long it stays active) compared with shorter-acting GHRH analogues.
Like other GHRH analogues, it acts as a GH secretagogue through the GHRH pathway, but FDA also notes that the DAC-related forms are not well characterized and may pose distinct safety risks.
Reported Use
No FDA dosing guidance
This peptide is not covered by FDA-labeled dosing guidance on this page. Peptides are often investigational or incompletely studied. Do not self-experiment; use only with a doctor or qualified clinician.
Typical dose
Published human studies used microgram-per-kilogram subcutaneous dosing rather than a single standard wellness dose.
Frequency
Weekly or biweekly schedules were used in short human studies.
Injection sites
Subcutaneous injection in published human studies.
Best timing
Time-of-day guidance is not the key source-backed issue; the evidence centers on dose and study schedule.
Effects timeline
After a single dose, GH rose for 6 days or more and IGF-I for 9-11 days in the published healthy-adult study.
Storage
FDA's compounding review discusses lyophilized bulk storage below -20 C; compounded handling is not standardized by approved labeling.
Cycle length
Published human studies lasted 28 or 49 days rather than establishing a general-purpose cycle.
Break between
Not established in an approved label or durable clinical standard.
Sequence
YADAIFTNSYRKVLAQLSARKLLQDILSRK
Loading viewer
Preparing 3D peptide scene
Quick Signals
At A Glance
A faster read on evidence, focus, structure, and status.
Evidence
Emerging human evidence
Published human evidence is limited to short healthy-adult studies showing sustained GH and IGF-I increases; FDA states…
26 indexed studiesCurrent level
Mixed human
Scale: low evidence to established use
Safety
Side Effects And Safety
Switch between common side-effect notes and stop criteria to keep safety context visible.
Reported or plausible side effects
- Other reported adverse effects included flushing, headache, nausea, abdominal pain, diarrhea, transient dizziness or hypotension, increased heart rate, and transient involuntary leg muscle contractions or coordination issues.
- FDA's 2024 review notes that long-term human safety is unknown and that DAC-related forms raised nonclinical concerns including local irritation signals, DNA-damage signals, and pituitary (the gland that helps control many hormone signals)-overstimulation concerns that cannot be ruled out.
Key cautions
- In healthy-adult studies, the most commonly reported adverse effects were injection-site reactions.
Molecule
Molecular Information
Core structure fields that help explain what kind of peptide this is and how much sequence detail is available.
Molecular weight
3647.95 Da
Chain length
29-aa core plus a C-terminal MPA-Lys DAC unit
Sequence type
GHRH analogue with Drug Affinity Complex
Derived from
Human GHRH(1-29) analogue.
Amino acid sequence source string
Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys
C-terminal maleimidopropionamide-lysine DAC moiety for albumin binding.
Context
Important Context
The main context that changes how confidently this peptide should be interpreted.
Research status
Published human evidence is limited to short healthy-adult studies showing sustained GH and IGF-I increases; FDA states there are no human effectiveness data for growth hormone deficiency.
Regulatory and sport status
FDA review: no FDA-approved product match found in openFDA, and FDA's 2024 compounding review weighed against adding CJC-1295-related DAC substances to the 503A Bulks List. Sport review: WADA prohibits growth hormone-releasing hormone and its analogues, including CJC-1295.
Blend composition
Single compoundSingle active ingredient: CJC-1295 DAC.
Route Notes
Route-Specific Notes
Only shown when the source material adds route-specific details beyond the quick-start guide.
Injectable
- Administration: Published human studies used subcutaneous dosing in healthy adults.
- Absorption: The DAC modification is intended to prolong exposure through albumin binding.
- Cycle: Published human studies lasted 28 or 49 days; a generic cycle standard is not established.
- Additional: The key source-backed regimens were weekly or biweekly microgram-per-kilogram protocols rather than fixed bodybuilding doses.
- Availability: Not applicable
Compare
How Well Documented Is It?
A quick five-point snapshot of how visible and well-documented this peptide is. Higher values mean more coverage or clearer status in that area, not better medical performance.
Research
How much published research coverage this peptide has in the linked sources, with an approval-context floor for clearly established drug products.
Source: PubMed
Regulatory
How clearly the approval or regulatory status is documented for this entry.
Source: openFDA drugsfda API
Sport
How clearly sports or competition status is documented in the linked review sources.
Source: 2026 WADA Prohibited List PDF
Breadth
How broadly this peptide appears across discussion topics and use-case groupings in the catalog.
Source: Curated site taxonomy
Sequence
How much structure or residue-sequence detail is available for this entry.
Source: Sequence
Protocols
Research Protocols
Common protocol-style rows shown in a consistent table layout so every peptide page is easy to compare.
| Goal | Dose | Route | Frequency |
|---|---|---|---|
| Healthy-adult PK / PD single-dose study | 30 or 60 mcg/kg | SubQ | Single-dose cohorts in the published study |
| Healthy-adult multiple-dose study | 20, 30, or 60 mcg/kg | SubQ | Weekly or biweekly dosing in the published multiple-dose study |
| Healthy-men GH pulsatility study | 60 or 90 mcg/kg | SubQ | Study-specific dosing reported in the published human trial |
Research
What It Has Been Studied For
Plain-language summaries of the main health areas where this peptide shows up in the linked research.
Stacking
What People Commonly Stack It With
A plain-language view of compounds that are commonly discussed alongside this peptide in the source material.
Practical
Preparation, Quality, And Expectations
Operational checklist blocks designed for quick scanning and repeatable page structure.
How to reconstitute
- •There is no approved standardized reconstitution protocol for CJC-1295 DAC.
- •FDA's review stresses that CJC-1295, CJC-1295 DAC, DAC acetate, and DAC TFA are distinct and not interchangeable.
- •Do not treat a generic BAC-water recipe as if it automatically applies across all DAC-related forms or compounded sources.
Quality indicators
Good signs
- Exact form clearly specified, such as DAC free base versus DAC acetate or DAC TFA.
- Identity and impurity testing that addresses aggregates, endotoxins, and peptide-related impurities.
- Source documentation that distinguishes DAC and non-DAC forms instead of blurring them together.
Avoid
- Any product that treats DAC and non-DAC CJC-1295 as interchangeable.
- Missing impurity, aggregate, or endotoxin controls.
- Unsupported claims of oral, troche, or bodybuilding-style fixed-dose equivalence.
What to expect
GH increased 2- to 10-fold for 6 days or more in the published healthy-adult study.
IGF-I increased 1.5- to 3-fold for 9-11 days.
Mean IGF-I levels remained above baseline for up to 28 days in the published study.
Longer-term benefit and safety claims go beyond the short human studies currently available.
References
Research And Source List
Structured reference cards with source metadata and a direct link so users can inspect the original study/source.
FDA review of CJC-1295-related bulk drug substances
FDA review | 2024
FDA review covering naming confusion, physical and chemical characterization problems, human and nonclinical safety concerns, and lack of effectiveness data for growth hormone deficiency.
PubMed: Teichman et al. 2006
JCEM | 2006
Healthy-adult study reporting sustained GH and IGF-I increases after subcutaneous CJC-1295, with an estimated half-life of 5.8-8.1 days and no serious adverse reactions reported in the abstract.
FDA UNII Search Service
FDA technical record
FDA technical record mapping CJC-1295 to UNII 62RC32V9N7 and linking the DAC-modified systematic name and related resources.
openFDA drugsfda API
FDA database | 2026 access
FDA approval-database query reviewed for CJC-1295 with DAC; no FDA-approved product match was found.
2026 WADA Prohibited List PDF
WADA | 2026
Current prohibited-list PDF explicitly naming growth hormone-releasing hormone and its analogues, including CJC-1295.
FDA compounding review of CJC-1295-related substances
FDA 2024 review of CJC-1295-related bulk drug substances covering naming confusion, physical and chemical characterization problems, human and nonclinical safety concerns, and lack of effectiveness data for growth hormone deficiency.
PubMed: Teichman et al. 2006
Published healthy-adult study reporting sustained GH and IGF-I increases after subcutaneous CJC-1295, with an estimated half-life of 5.8-8.1 days and no serious adverse reactions reported in the abstract.