Growth & Recovery Peptides
Injectable mode
CJC-1295 with DAC
Peptide type: GHRH analog with DAC
Limited structure detail

This entry does not currently have a verified structure file for the interactive viewer, so structure presentation is limited.

Help improve the information

Suggest a correction, missing detail, or peptide addition by .

Not FDA approved

This peptide is not FDA approved for human use, and because peptides are often incompletely studied you should not use or self-experiment with it outside qualified medical supervision.

Overview

CJC-1295 DAC is a long-acting growth hormone-releasing hormone version in which CJC-1295 has a maleimidopropionamide-lysine Drug Affinity Complex added to prolong albumin binding and exposure. It is not FDA approved, is prohibited by WADA, and the published human data are limited to short healthy-adult studies showing sustained GH and IGF-I increases rather than proof of benefit for growth hormone deficiency or body composition.

Reported benefits

  • Published human pharmacokinetic and pharmacodynamic data in healthy adults.
  • Long-acting design intended to extend exposure through albumin binding.
  • Sustained GH and IGF-I increases after subcutaneous dosing in short studies.

Mechanism of action

FDA's 2024 review describes CJC-1295 DAC as CJC-1295 with a maleimidopropionamide-lysine unit added at the C terminus. That DAC modification enables in-vivo bioconjugation with serum albumin and contributes to the longer half-life (how long it stays active) compared with shorter-acting GHRH analogues.

Like other GHRH analogues, it acts as a GH secretagogue through the GHRH pathway, but FDA also notes that the DAC-related forms are not well characterized and may pose distinct safety risks.

Reported Use

Injectable mode

No FDA dosing guidance

This peptide is not covered by FDA-labeled dosing guidance on this page. Peptides are often investigational or incompletely studied. Do not self-experiment; use only with a doctor or qualified clinician.

Typical dose

Published human studies used microgram-per-kilogram subcutaneous dosing rather than a single standard wellness dose.

Frequency

Weekly or biweekly schedules were used in short human studies.

Injection sites

Subcutaneous injection in published human studies.

Best timing

Time-of-day guidance is not the key source-backed issue; the evidence centers on dose and study schedule.

Effects timeline

After a single dose, GH rose for 6 days or more and IGF-I for 9-11 days in the published healthy-adult study.

Storage

FDA's compounding review discusses lyophilized bulk storage below -20 C; compounded handling is not standardized by approved labeling.

Cycle length

Published human studies lasted 28 or 49 days rather than establishing a general-purpose cycle.

Break between

Not established in an approved label or durable clinical standard.

Sequence

30 aa

YADAIFTNSYRKVLAQLSARKLLQDILSRK

Loading viewer

Preparing 3D peptide scene

Quick Signals

At A Glance

A faster read on evidence, focus, structure, and status.

Evidence

Emerging human evidence

Published human evidence is limited to short healthy-adult studies showing sustained GH and IGF-I increases; FDA states…

26 indexed studies

Current level

Mixed human

Scale: low evidence to established use

Most discussed for

Muscle growth

It is not FDA approved, is prohibited by WADA, and published human data are limited to short healthy-adult studies showing sustained GH and IGF-I increases rather than proof of benefit for growth hormone deficiency or b…

Status

Regulatory and sport context

Not approved

No FDA-approved label is surfaced for this entry. Compounding and prescribing status can differ from FDA approval status.

Sport restricted

This entry is treated as prohibited in competitive sport.

Safety

Side Effects And Safety

Switch between common side-effect notes and stop criteria to keep safety context visible.

Reported or plausible side effects

  • Other reported adverse effects included flushing, headache, nausea, abdominal pain, diarrhea, transient dizziness or hypotension, increased heart rate, and transient involuntary leg muscle contractions or coordination issues.
  • FDA's 2024 review notes that long-term human safety is unknown and that DAC-related forms raised nonclinical concerns including local irritation signals, DNA-damage signals, and pituitary (the gland that helps control many hormone signals)-overstimulation concerns that cannot be ruled out.

Key cautions

  • In healthy-adult studies, the most commonly reported adverse effects were injection-site reactions.

Molecule

Molecular Information

Core structure fields that help explain what kind of peptide this is and how much sequence detail is available.

Molecular weight

3647.95 Da

Chain length

29-aa core plus a C-terminal MPA-Lys DAC unit

Sequence type

GHRH analogue with Drug Affinity Complex

Derived from

Human GHRH(1-29) analogue.

Amino acid sequence source string

Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys

C-terminal maleimidopropionamide-lysine DAC moiety for albumin binding.

Context

Important Context

The main context that changes how confidently this peptide should be interpreted.

Research status

Published human evidence is limited to short healthy-adult studies showing sustained GH and IGF-I increases; FDA states there are no human effectiveness data for growth hormone deficiency.

Regulatory and sport status

FDA review: no FDA-approved product match found in openFDA, and FDA's 2024 compounding review weighed against adding CJC-1295-related DAC substances to the 503A Bulks List. Sport review: WADA prohibits growth hormone-releasing hormone and its analogues, including CJC-1295.

Blend composition

Single compound
Not a blend

Single active ingredient: CJC-1295 DAC.

Route Notes

Route-Specific Notes

Only shown when the source material adds route-specific details beyond the quick-start guide.

Injectable

  • Administration: Published human studies used subcutaneous dosing in healthy adults.
  • Absorption: The DAC modification is intended to prolong exposure through albumin binding.
  • Cycle: Published human studies lasted 28 or 49 days; a generic cycle standard is not established.
  • Additional: The key source-backed regimens were weekly or biweekly microgram-per-kilogram protocols rather than fixed bodybuilding doses.
  • Availability: Not applicable

Compare

How Well Documented Is It?

A quick five-point snapshot of how visible and well-documented this peptide is. Higher values mean more coverage or clearer status in that area, not better medical performance.

ResearchRegulatorySportBreadthSequence

Research

How much published research coverage this peptide has in the linked sources, with an approval-context floor for clearly established drug products.

Source: PubMed

Score: 10

Regulatory

How clearly the approval or regulatory status is documented for this entry.

Source: openFDA drugsfda API

Score: 10

Sport

How clearly sports or competition status is documented in the linked review sources.

Source: 2026 WADA Prohibited List PDF

Score: 0

Breadth

How broadly this peptide appears across discussion topics and use-case groupings in the catalog.

Source: Curated site taxonomy

Score: 72

Sequence

How much structure or residue-sequence detail is available for this entry.

Source: Sequence

Score: 60

Protocols

Research Protocols

Common protocol-style rows shown in a consistent table layout so every peptide page is easy to compare.

GoalDoseRouteFrequency
Healthy-adult PK / PD single-dose study30 or 60 mcg/kgSubQSingle-dose cohorts in the published study
Healthy-adult multiple-dose study20, 30, or 60 mcg/kgSubQWeekly or biweekly dosing in the published multiple-dose study
Healthy-men GH pulsatility study60 or 90 mcg/kgSubQStudy-specific dosing reported in the published human trial

Research

What It Has Been Studied For

Plain-language summaries of the main health areas where this peptide shows up in the linked research.

Published studies showed sustained GH and IGF-I increases after subcutaneous dosing.
FDA states there are no human effectiveness data for CJC-1295-related substances in people with growth hormone deficiency.
FDA notes the human studies did not measure body-composition endpoints and do not establish effectiveness for those uses.

Stacking

What People Commonly Stack It With

A plain-language view of compounds that are commonly discussed alongside this peptide in the source material.

Formal interaction data are lacking, and stacking advice is largely speculative.
Shared GH / IGF-I pathway effects mean overlap should not be assumed safe or useful without specialist oversight.

Practical

Preparation, Quality, And Expectations

Operational checklist blocks designed for quick scanning and repeatable page structure.

How to reconstitute

  1. There is no approved standardized reconstitution protocol for CJC-1295 DAC.
  2. FDA's review stresses that CJC-1295, CJC-1295 DAC, DAC acetate, and DAC TFA are distinct and not interchangeable.
  3. Do not treat a generic BAC-water recipe as if it automatically applies across all DAC-related forms or compounded sources.

Quality indicators

Good signs

  • Exact form clearly specified, such as DAC free base versus DAC acetate or DAC TFA.
  • Identity and impurity testing that addresses aggregates, endotoxins, and peptide-related impurities.
  • Source documentation that distinguishes DAC and non-DAC forms instead of blurring them together.

Avoid

  • Any product that treats DAC and non-DAC CJC-1295 as interchangeable.
  • Missing impurity, aggregate, or endotoxin controls.
  • Unsupported claims of oral, troche, or bodybuilding-style fixed-dose equivalence.

What to expect

After a single dose

GH increased 2- to 10-fold for 6 days or more in the published healthy-adult study.

After a single dose

IGF-I increased 1.5- to 3-fold for 9-11 days.

After repeated doses

Mean IGF-I levels remained above baseline for up to 28 days in the published study.

Longer term

Longer-term benefit and safety claims go beyond the short human studies currently available.

References

Research And Source List

Structured reference cards with source metadata and a direct link so users can inspect the original study/source.