Growth & Recovery Peptides
Injectable mode
CJC-1295 (without DAC)
Peptide type: GHRH analog (Mod GRF 1-29)

Help improve the information

Suggest a correction, missing detail, or peptide addition by .

Not FDA approved

This peptide is not FDA approved for human use, and because peptides are often incompletely studied you should not use or self-experiment with it outside qualified medical supervision.

Overview

CJC-1295 without DAC is the short-acting, marketed Mod GRF 1-29 form of a growth hormone-releasing hormone (GHRH) version. The reviewed source set shows that the best-known human CJC-1295 papers are on the long-acting version, while exact no-DAC claims are often conflated with that DAC literature or with gray-market protocol copy.

No FDA-approved no-DAC product was identified.

Reported benefits

  • Clear GHRH-analogue concept and a commonly claimed short-acting distinction from the DAC form.
  • Human CJC-1295 endocrine literature exists, but the better-known published studies are long-acting and DAC-focused.
  • Useful as a GH/IGF-axis research-category reference, not as a validated consumer-use protocol.
  • No FDA-approved product identified.

Mechanism of action

The no-DAC version is generally marketed as a modified GHRH(1-29) version intended to stimulate pituitary (the gland that helps control many hormone signals) growth hormone release without the albumin-binding DAC extension used in long-acting CJC-1295. That overall GHRH-receptor biology is plausible.

What the current source set does not justify is strong certainty about exact half-life (how long it stays active), receptor behavior, or superior physiologic pulsatility for the exact no-DAC product page.

Reported Use

Injectable mode

No FDA dosing guidance

This peptide is not covered by FDA-labeled dosing guidance on this page. Peptides are often investigational or incompletely studied. Do not self-experiment; use only with a doctor or qualified clinician.

Typical dose

No source-backed casual human dosing protocol was identified for exact CJC-1295 without DAC

Frequency

Not established

Injection sites

Marketed as an injectable GHRH analogue, but the better-known published CJC-1295 human papers are DAC-focused and should not be copied over as a no-DAC protocol

Best timing

Not established

Effects timeline

Not established for the exact no-DAC form from the reviewed human literature

Storage

Do not treat forum-style mixing or storage instructions as validated medical guidance

Cycle length

Not established

Break between

Not established

Sequence

30 aa

YADAIFTNSYRKVLAQLSARKLLQDILSRK

Loading viewer

Preparing 3D peptide scene

Quick Signals

At A Glance

A faster read on evidence, focus, structure, and status.

Evidence

Emerging human evidence

The reviewed human CJC-1295 papers are centered on the long-acting analog, while exact no-DAC and Modified GRF 1-29 cla…

27 indexed studies

Current level

Mixed human

Scale: low evidence to established use

Most discussed for

Growth hormone support

CJC-1295 without DAC is the short-acting, marketed Mod GRF 1-29 form of a GHRH analogue.

Status

Regulatory and sport context

Not approved

No FDA-approved label is surfaced for this entry. Compounding and prescribing status can differ from FDA approval status.

Sport restricted

This entry is treated as prohibited in competitive sport.

Safety

Side Effects And Safety

Switch between common side-effect notes and stop criteria to keep safety context visible.

Reported or plausible side effects

  • Injection-site reactions, flushing, edema, headache, paresthesias, or glucose-related effects are better treated as pathway-level or route-level cautions than as proven no-DAC trial results.

Key cautions

  • No FDA-labeled safety profile exists for exact CJC-1295 without DAC.
  • Common no-DAC safety claims online should be treated cautiously because the better-indexed human CJC-1295 studies are on the long-acting version.
  • Product identity and formulation confusion are major concerns because no-DAC, DAC, and related GHRH analogues are often mislabeled or conflated.

Molecule

Molecular Information

Core structure fields that help explain what kind of peptide this is and how much sequence detail is available.

Molecular weight

Not established in the current verified source bundle with enough exact-form certainty

Chain length

Commonly marketed as 30 amino acids

Sequence type

Modified GHRH(1-29) analogue / Mod GRF 1-29

Derived from

Human GHRH(1-29) analogue design

Amino acid sequence source string

A marketed 30 aa backbone is commonly associated with no-DAC CJC-1295, but the reviewed registry trail did not cleanly separate exact no-DAC identity from DAC-linked records.

Usually described as a set of substitutions intended to improve stability without the DAC extension.

Context

Important Context

The main context that changes how confidently this peptide should be interpreted.

Research status

The reviewed human CJC-1295 papers are centered on the long-acting version, while exact no-DAC and Modified GRF 1-29 claims are frequently mixed with DAC literature, doping-detection literature, or community-use claims.

Regulatory and sport status

FDA review shows it is not FDA approved. Source: openFDA drugsfda API. Sport review shows it is prohibited in sport.

Use extra caution if

  • No product-specific FDA label was identified; use caution around GH/IGF-axis symptoms, product identity, and anti-doping relevance.

Route Notes

Route-Specific Notes

Only shown when the source material adds route-specific details beyond the quick-start guide.

Injectable

  • Administration: Marketed as injectable, but exact no-DAC consumer-use protocol was not validated in the reviewed source set.
  • Absorption: Not established.
  • Cycle: Not established.
  • Additional: Better-known published CJC-1295 human papers are long-acting analog studies.

Compare

How Well Documented Is It?

A quick five-point snapshot of how visible and well-documented this peptide is. Higher values mean more coverage or clearer status in that area, not better medical performance.

ResearchRegulatorySportBreadthSequence

Research

How much published research coverage this peptide has in the linked sources, with an approval-context floor for clearly established drug products.

Source: PubMed

Score: 11

Regulatory

How clearly the approval or regulatory status is documented for this entry.

Source: openFDA drugsfda API

Score: 10

Sport

How clearly sports or competition status is documented in the linked review sources.

Source: 2026 WADA Prohibited List PDF

Score: 0

Breadth

How broadly this peptide appears across discussion topics and use-case groupings in the catalog.

Source: Curated site taxonomy

Score: 72

Sequence

How much structure or residue-sequence detail is available for this entry.

Source: Sequence

Score: 60

Protocols

Research Protocols

Common protocol-style rows shown in a consistent table layout so every peptide page is easy to compare.

GoalDoseRouteFrequency
Exact no-DAC / Mod GRF 1-29 literatureNot established in the reviewed source set as a validated consumer-use protocolNot cleanly establishedNot established
Broader published human CJC-1295 endocrine studiesStudy-specificHuman studies better identified in the reviewed source set involve the long-acting analog and should not be transferred directly to the no-DAC pageStudy-specific

Research

What It Has Been Studied For

Plain-language summaries of the main health areas where this peptide shows up in the linked research.

The better-known studies are long-acting and DAC-focused rather than clean proof for exact no-DAC use.
The reviewed source set did not identify a clean modern clinical evidence package validating common community protocol claims.
CJC-1295 and related GHRH analogues appear in the anti-doping analytical literature and WADA prohibited-list context.

Stacking

What People Commonly Stack It With

A plain-language view of compounds that are commonly discussed alongside this peptide in the source material.

Commonly marketed together, but the reviewed source set does not establish a validated safe no-DAC stack.
Overlapping GH/IGF-axis effects could increase edema or glucose-related issues.
Overlapping pathway exposure is not source-backed as a useful strategy.
GH/IGF-axis manipulation can affect glucose handling.

Practical

Preparation, Quality, And Expectations

Operational checklist blocks designed for quick scanning and repeatable page structure.

How to reconstitute

  1. No validated consumer reconstitution protocol was identified for exact CJC-1295 without DAC.
  2. Do not treat generic BAC-water or syringe-unit instructions as source-backed medical guidance.
  3. Identity, concentration, and DAC-vs-no-DAC labeling should be considered unresolved unless independently documented.

Quality indicators

Good signs

  • Product identity clearly distinguishes no-DAC material from CJC-1295 with DAC.
  • Source trail clearly separates DAC human data from no-DAC claims.
  • Regulatory and sports status are checked against official sources.

Avoid

  • Long-acting CJC-1295 human studies being cited as if they automatically prove the no-DAC page.
  • Confident half-life, timing, or stack claims without a direct source trail.
  • Generic reconstitution or cycle advice presented as established medical protocol.
  • Unclear labeling, sterility, concentration, or formulation claims.

What to expect

Evidence review outcome

No reliable consumer expectation timeline was established for exact CJC-1295 without DAC.

Published human literature context

Reviewed CJC-1295 human papers are better suited to endocrine-study context than to a polished self-use timeline.