Help improve the information
Suggest a correction, missing detail, or peptide addition by .
Not FDA approved
This peptide is not FDA approved for human use, and because peptides are often incompletely studied you should not use or self-experiment with it outside qualified medical supervision.
Overview
CJC-1295 without DAC is the short-acting, marketed Mod GRF 1-29 form of a growth hormone-releasing hormone (GHRH) version. The reviewed source set shows that the best-known human CJC-1295 papers are on the long-acting version, while exact no-DAC claims are often conflated with that DAC literature or with gray-market protocol copy.
No FDA-approved no-DAC product was identified.
Reported benefits
- Clear GHRH-analogue concept and a commonly claimed short-acting distinction from the DAC form.
- Human CJC-1295 endocrine literature exists, but the better-known published studies are long-acting and DAC-focused.
- Useful as a GH/IGF-axis research-category reference, not as a validated consumer-use protocol.
- No FDA-approved product identified.
Mechanism of action
The no-DAC version is generally marketed as a modified GHRH(1-29) version intended to stimulate pituitary (the gland that helps control many hormone signals) growth hormone release without the albumin-binding DAC extension used in long-acting CJC-1295. That overall GHRH-receptor biology is plausible.
What the current source set does not justify is strong certainty about exact half-life (how long it stays active), receptor behavior, or superior physiologic pulsatility for the exact no-DAC product page.
Reported Use
No FDA dosing guidance
This peptide is not covered by FDA-labeled dosing guidance on this page. Peptides are often investigational or incompletely studied. Do not self-experiment; use only with a doctor or qualified clinician.
Typical dose
No source-backed casual human dosing protocol was identified for exact CJC-1295 without DAC
Frequency
Not established
Injection sites
Marketed as an injectable GHRH analogue, but the better-known published CJC-1295 human papers are DAC-focused and should not be copied over as a no-DAC protocol
Best timing
Not established
Effects timeline
Not established for the exact no-DAC form from the reviewed human literature
Storage
Do not treat forum-style mixing or storage instructions as validated medical guidance
Cycle length
Not established
Break between
Not established
Sequence
YADAIFTNSYRKVLAQLSARKLLQDILSRK
Loading viewer
Preparing 3D peptide scene
Quick Signals
At A Glance
A faster read on evidence, focus, structure, and status.
Evidence
Emerging human evidence
The reviewed human CJC-1295 papers are centered on the long-acting analog, while exact no-DAC and Modified GRF 1-29 cla…
27 indexed studiesCurrent level
Mixed human
Scale: low evidence to established use
Safety
Side Effects And Safety
Switch between common side-effect notes and stop criteria to keep safety context visible.
Reported or plausible side effects
- Injection-site reactions, flushing, edema, headache, paresthesias, or glucose-related effects are better treated as pathway-level or route-level cautions than as proven no-DAC trial results.
Key cautions
- No FDA-labeled safety profile exists for exact CJC-1295 without DAC.
- Common no-DAC safety claims online should be treated cautiously because the better-indexed human CJC-1295 studies are on the long-acting version.
- Product identity and formulation confusion are major concerns because no-DAC, DAC, and related GHRH analogues are often mislabeled or conflated.
Molecule
Molecular Information
Core structure fields that help explain what kind of peptide this is and how much sequence detail is available.
Molecular weight
Not established in the current verified source bundle with enough exact-form certainty
Chain length
Commonly marketed as 30 amino acids
Sequence type
Modified GHRH(1-29) analogue / Mod GRF 1-29
Derived from
Human GHRH(1-29) analogue design
Amino acid sequence source string
A marketed 30 aa backbone is commonly associated with no-DAC CJC-1295, but the reviewed registry trail did not cleanly separate exact no-DAC identity from DAC-linked records.
Usually described as a set of substitutions intended to improve stability without the DAC extension.
Context
Important Context
The main context that changes how confidently this peptide should be interpreted.
Research status
The reviewed human CJC-1295 papers are centered on the long-acting version, while exact no-DAC and Modified GRF 1-29 claims are frequently mixed with DAC literature, doping-detection literature, or community-use claims.
Regulatory and sport status
FDA review shows it is not FDA approved. Source: openFDA drugsfda API. Sport review shows it is prohibited in sport.
Use extra caution if
- • No product-specific FDA label was identified; use caution around GH/IGF-axis symptoms, product identity, and anti-doping relevance.
Route Notes
Route-Specific Notes
Only shown when the source material adds route-specific details beyond the quick-start guide.
Injectable
- Administration: Marketed as injectable, but exact no-DAC consumer-use protocol was not validated in the reviewed source set.
- Absorption: Not established.
- Cycle: Not established.
- Additional: Better-known published CJC-1295 human papers are long-acting analog studies.
Compare
How Well Documented Is It?
A quick five-point snapshot of how visible and well-documented this peptide is. Higher values mean more coverage or clearer status in that area, not better medical performance.
Research
How much published research coverage this peptide has in the linked sources, with an approval-context floor for clearly established drug products.
Source: PubMed
Regulatory
How clearly the approval or regulatory status is documented for this entry.
Source: openFDA drugsfda API
Sport
How clearly sports or competition status is documented in the linked review sources.
Source: 2026 WADA Prohibited List PDF
Breadth
How broadly this peptide appears across discussion topics and use-case groupings in the catalog.
Source: Curated site taxonomy
Sequence
How much structure or residue-sequence detail is available for this entry.
Source: Sequence
Protocols
Research Protocols
Common protocol-style rows shown in a consistent table layout so every peptide page is easy to compare.
| Goal | Dose | Route | Frequency |
|---|---|---|---|
| Exact no-DAC / Mod GRF 1-29 literature | Not established in the reviewed source set as a validated consumer-use protocol | Not cleanly established | Not established |
| Broader published human CJC-1295 endocrine studies | Study-specific | Human studies better identified in the reviewed source set involve the long-acting analog and should not be transferred directly to the no-DAC page | Study-specific |
Research
What It Has Been Studied For
Plain-language summaries of the main health areas where this peptide shows up in the linked research.
Stacking
What People Commonly Stack It With
A plain-language view of compounds that are commonly discussed alongside this peptide in the source material.
Practical
Preparation, Quality, And Expectations
Operational checklist blocks designed for quick scanning and repeatable page structure.
How to reconstitute
- •No validated consumer reconstitution protocol was identified for exact CJC-1295 without DAC.
- •Do not treat generic BAC-water or syringe-unit instructions as source-backed medical guidance.
- •Identity, concentration, and DAC-vs-no-DAC labeling should be considered unresolved unless independently documented.
Quality indicators
Good signs
- Product identity clearly distinguishes no-DAC material from CJC-1295 with DAC.
- Source trail clearly separates DAC human data from no-DAC claims.
- Regulatory and sports status are checked against official sources.
Avoid
- Long-acting CJC-1295 human studies being cited as if they automatically prove the no-DAC page.
- Confident half-life, timing, or stack claims without a direct source trail.
- Generic reconstitution or cycle advice presented as established medical protocol.
- Unclear labeling, sterility, concentration, or formulation claims.
What to expect
No reliable consumer expectation timeline was established for exact CJC-1295 without DAC.
Reviewed CJC-1295 human papers are better suited to endocrine-study context than to a polished self-use timeline.
References
Research And Source List
Structured reference cards with source metadata and a direct link so users can inspect the original study/source.
FDA compounding review of CJC-1295-related substances
FDA review
Official review covering naming confusion, characterization problems, and limited effectiveness and safety support across CJC-1295-related substances.
Teichman et al. 2006
JCEM
Key human paper often cited online; importantly, it is on the long-acting analog.
Ionescu and Frohman 2006
JCEM
Another key human paper showing the same long-acting framing.
Refined PubMed search
Research
Query used to review indexed CJC-1295 and Modified GRF 1-29 visibility.
2026 WADA Prohibited List PDF
WADA
Current WADA list naming growth hormone-releasing hormone and its analogues, including CJC-1295.
FDA compounding review of CJC-1295-related substances
FDA 2024 review covering naming confusion, characterization problems, and limited effectiveness and safety support across CJC-1295-related substances.
PubMed: Teichman et al. 2006
Published healthy-adult study on CJC-1295 explicitly described as a long-acting analog of GH-releasing hormone.